PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G078700.1.p
Common NameSb10g006820, SORBIDRAFT_10g006820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 701aa    MW: 76538.5 Da    PI: 6.2845
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G078700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.9e-211671156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  Sobic.010G078700.1.p 16 RKRYHRHTPRQIQQLEAMFKECPHPDENQRAALSRELGLEPRQIKFWFQNRRTQMK 71
                          789999***********************************************998 PP

2START148.75.3e-472154383206
                           HHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                 START   3 aeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           a +a++el+++a+a+++ Wvk       e++n  ++ + f++ +v       ++e +r+sg+v+m ++ lv  ++d++ +W e ++   
  Sobic.010G078700.1.p 215 ATRAMDELIRLAQAGDQIWVKGMpgdarEMLNVATYDSLFSKPGVafrppdMNVEGSRDSGLVFMSAVALVDVFMDTN-KWMEFFPgiv 302
                           6789*****************988999999999999999988777*********************************.********** PP

                           .EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                 START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                            ka+t++v+ +g     + l  m+ el  ++p+vp R+  f+Ry++q ++g w+i+dvS+d +++        R+++ pSg+li ++sn
  Sobic.010G078700.1.p 303 sKAQTVDVLVNGlggrsESLIMMYEELHIMTPVVPtRELSFLRYCKQIEQGLWAIADVSLDGQRDAH-YGMPSRSRRMPSGCLIADMSN 390
                           *****************************************************************98.56667999************* PP

                           CEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 160 ghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                           g+skvtwveh++ +  lp   l+r lv sg+a+ga +w+a+lqr ce+
  Sobic.010G078700.1.p 391 GYSKVTWVEHMEIEQMLPiNVLYRNLVLSGAAFGAHRWLAALQRACER 438
                           ******************999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.97E-20976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-221078IPR009057Homeodomain-like
PROSITE profilePS5007117.7831373IPR001356Homeobox domain
SMARTSM003894.5E-191477IPR001356Homeobox domain
PfamPF000462.5E-181671IPR001356Homeobox domain
CDDcd000863.04E-191674No hitNo description
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084845.603204441IPR002913START domain
SuperFamilySSF559611.79E-30204440No hitNo description
CDDcd088754.46E-103208437No hitNo description
SMARTSM002341.6E-31213438IPR002913START domain
PfamPF018523.2E-39215438IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-4326413IPR023393START-like domain
SuperFamilySSF559616.96E-19456692No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRQRKRYH RHTPRQIQQL EAMFKECPHP DENQRAALSR ELGLEPRQIK  60
FWFQNRRTQM KAQHERADNC FLRAENDKIR CENITMREAL KNVICPNCGG PPVAEDFFDE  120
QKLRMENARL KEELDRVSSI TSKYLGRPFT QMPPVPTMSM SSLDLSMGGM PGQQGHLGGP  180
PSLDLDLLSG CSSGMPYQMP APVTEMERPM MVDMATRAMD ELIRLAQAGD QIWVKGMPGD  240
AREMLNVATY DSLFSKPGVA FRPPDMNVEG SRDSGLVFMS AVALVDVFMD TNKWMEFFPG  300
IVSKAQTVDV LVNGLGGRSE SLIMMYEELH IMTPVVPTRE LSFLRYCKQI EQGLWAIADV  360
SLDGQRDAHY GMPSRSRRMP SGCLIADMSN GYSKVTWVEH MEIEQMLPIN VLYRNLVLSG  420
AAFGAHRWLA ALQRACERFA SVATLGVPHH DIAGVTPEGK RSMMKLSQRM VGSFCASLSS  480
SPLQRWTLLS GTTDVSVRVS THRSTDSGGQ PNGVVLSAAT SIWLPVPGDH VFAFVRDENA  540
RSQWDVLSHG NQVQEVSRIP NGSNPGNCIS LLRGLNANQN SMLILQESCT DASGALVVYS  600
PIDIPAANVV MSGEDPSGIP LLPSGFAILP DGRPGSGAGA SSSVVLPLAS QPGCVVTVAF  660
QILVSNLPSS RLNAESVATV NSLIGTTVQQ IKAALNCAGP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0668130.0BT066813.2 Zea mays full-length cDNA clone ZM_BFb0073D09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438026.10.0hypothetical protein SORBIDRAFT_10g006820
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLC5Z6D60.0C5Z6D6_SORBI; Putative uncharacterized protein Sb10g006820
STRINGSb10g006820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11